PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6373_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 298aa    MW: 33485.4 Da    PI: 9.3485
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6373_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285.1e-092873346
                                         SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                                         +WT+eE +++  a +++ ++   +W  +a++++ g+t ++++  ++ 
  cra_locus_6373_iso_1_len_2422_ver_3 28 KWTPEENKKFETALALFDKDtpdRWYNVAAMIP-GKTVNDVIKQYRE 73
                                         8********************************.********99986 PP

2Myb_DNA-binding46.21.1e-14134178347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  cra_locus_6373_iso_1_len_2422_ver_3 134 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 178
                                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-42375IPR009057Homeodomain-like
PROSITE profilePS512937.9572479IPR017884SANT domain
SMARTSM007172.5E-102577IPR001005SANT/Myb domain
CDDcd001672.13E-82875No hitNo description
SuperFamilySSF466896.36E-122882IPR009057Homeodomain-like
PfamPF002494.6E-82874IPR001005SANT/Myb domain
PROSITE profilePS5129421.106127183IPR017930Myb domain
SuperFamilySSF466892.44E-17129182IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-18130182IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-12131178IPR009057Homeodomain-like
SMARTSM007173.5E-13131181IPR001005SANT/Myb domain
CDDcd001672.14E-11134179No hitNo description
PfamPF002493.9E-12134178IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNRGMEILSP ASYLGNSSWL FEETKVTKWT PEENKKFETA LALFDKDTPD RWYNVAAMIP  60
GKTVNDVIKQ YRELVEDVSD IEAGLIPIPG YGSNSFTLEW ATNQGHDGLK QFYGPAGKRN  120
SSTRSDHERK KGVPWTEEEH RQFLLGLKKY GKGDWRNISR NFVTTRTPTQ VASHAQKYFI  180
RQLSGGKDRR RSSIHDITTV NLAEIKPLQA EDSSPPSSTD LSQKHSNMNG MSRAVYGLPN  240
QGATTTMAFN VPNNGLTTMP YSGDASYDQK PHERGISLHG IQFGQSNTMF QMQSAPHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1829911173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016542286.11e-142PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-103DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068UD681e-151A0A068UD68_COFCA; Uncharacterized protein
STRINGSolyc09g014250.2.11e-141(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140